NexPept
Laboratory Research Supply
RESEARCH CATALOGUE
Mix & Match Any Peptides
Full Catalogue
Metabolic Research
Cellular Research
Secretagogue Research
Neuro Research
Research Blends
Laboratory Supplies
3+ items5%
5+ items10%
10+ items20%
ABOUT NEXPEPT
NexPept Rewards Become an Affiliate Partner Our Quality Standards About UsRESEARCH TOOLS & DOCS
Research Articles Peptide Calculator Certificates of Analysis Shipping & Delivery FAQACCOUNT
Track Your Order Account Login My Points & RewardsVerified Reviews
For Research Use Only
All products are intended for laboratory research use only. Not for human or veterinary use.
Mix & match any peptides:
3+ save 5%
5+ save 10%
10+ save 20%
View the COA Library
Tools & Support
Research Articles
99%+ Purity Verified
Research Use Only
Secure Checkout
All products are supplied strictly for laboratory research use. Not for human or veterinary use.
Third-Party Tested
Research Use Only
Batch Tracked
VIP 5MG
SKU NP-VIP-5MG
$60.00
CAD
Order within
Mix & Match All Peptides
Any products, any strengths — the discount counts your whole cart
3 vials5% off
5 vials10% off
10 vials20% off
Same-day dispatch before 2 PM ET
Orders after the cutoff ship the next business day
Free shipping over $250
Discreet, tracked Canada Post on every order
Ships from Ontario
Typically 1–2 business days across Canada
Third-party tested, batch-tracked
HPLC and mass-spec verified, COA for every lot
Secure encrypted checkout
Crypto 10% off
e-Transfer
Credit/Debit
VIP
|
Vasoactive Intestinal Peptide — C-Terminally Amidated Neuropeptide
Receptor Target
VPAC1 / VPAC2
Research Pathway
Gαs — cAMP / PKA
Origin
Neuroendocrine / Endogenous
Vasoactive Intestinal Peptide (VIP) is a 28-residue C-terminally amidated neuropeptide first isolated from porcine duodenum by Said and Mutt in 1970. It belongs to the secretin/glucagon superfamily and shares substantial sequence homology with PACAP, with which it shares receptor targets. VIP signals through the class B G-protein-coupled receptors VPAC1 and VPAC2, coupling predominantly to Gαs and elevating intracellular cAMP. It is distributed widely across enteric, central and peripheral neurons, and is among the most extensively studied neuropeptides in smooth-muscle, circadian and immunological research models.
Molecular Profile
| Property | Detail |
|---|---|
| Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂ |
| Single-Letter Code | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ |
| Residue Count | 28 AA (neuropeptide) |
| C-Terminus | Amidated (Asn²⁸-NH₂); free N-terminal His¹ |
| Molecular Formula | C₁₄₇H₂₃₇N₄₃O₄₃S |
| Molecular Weight | ~3326.8 Da |
| CAS Number | 40077-57-4 (human sequence) |
| Also Known As | Vasoactive intestinal polypeptide; Aviptadil (synthetic clinical name) |
| Gene / UniProt | VIP (human) — UniProt P01282 |
| Peptide Family | Secretin/glucagon superfamily; PACAP-related |
| Format | Lyophilized Powder — 5 mg/vial |
| Purity Specification | ≥98% (HPLC) |
Research Targets & Proposed Mechanisms
VPAC1
Class B GPCR with high VIP affinity; reported in pulmonary tissue and T-lymphocyte populations. Studied in epithelial and immune cell signalling assays.
VPAC2
Second class B GPCR target; reported in smooth muscle, mast cells and basal lung mucosa. Investigated in smooth-muscle relaxation and secretory model systems.
Gαs / cAMP / PKA
Canonical downstream cascade: receptor activation stimulates adenylyl cyclase, raising cAMP and activating protein kinase A. Standard readout in receptor pharmacology assays.
Shared receptor pharmacology: VIP and PACAP bind VPAC1 and VPAC2 with comparable affinity, while PACAP additionally binds the PAC1 receptor, at which VIP is substantially weaker. That selectivity difference is routinely exploited in receptor-mapping experiments to distinguish VPAC-mediated from PAC1-mediated responses, which is a large part of why VIP is used as a reference ligand in this field.
Research Context
- →First isolated from porcine small intestine by Sami Said and Viktor Mutt in 1970; originally characterised by its vasodilatory activity, from which the name derives
- →Used as a reference ligand in VPAC1/VPAC2 receptor pharmacology, including competitive binding, cAMP accumulation and receptor-subtype selectivity assays
- →Studied extensively in circadian biology; VIP-expressing neurons of the suprachiasmatic nucleus are a long-standing model for intercellular synchronisation of circadian oscillators
- →Investigated in immunological research for proposed effects on T-cell differentiation, regulatory T-cell populations and cytokine profiles in in vitro model systems
- →Examined in enteric neuroscience as a principal non-adrenergic, non-cholinergic mediator in gastrointestinal smooth-muscle preparations
- →The synthetic form, aviptadil, has been developed and investigated clinically in several jurisdictions, providing an extensive translational data set alongside the preclinical literature
Storage & Handling
Store sealed lyophilized material under controlled laboratory conditions in accordance with validated institutional SOPs and applicable technical documentation. Protect from light and moisture.
- →Keep in original sealed vial until use in research protocols
- →The sequence contains a single methionine residue (Met¹⁷), which is susceptible to oxidation; minimise exposure to air and oxidising conditions during handling
- →Asparagine and glutamine residues render the peptide susceptible to deamidation under extremes of pH; buffer selection should be documented in the protocol
- →The lyophilized material is hygroscopic; allow vials to reach ambient temperature before opening to avoid condensation
- →Handle in accordance with institutional biosafety and chemical handling guidelines
Literature & Resources
- →UniProt — VIP_HUMAN (P01282), full precursor sequence and processing: uniprot.org
- →PubMed — vasoactive intestinal peptide, VPAC receptor pharmacology: peer-reviewed literature search
- →PubMed — VIP and suprachiasmatic nucleus circadian research: peer-reviewed literature search
- →NexPept COA Library — published certificates for every batch we have sold: view library
Research Use Only. Vasoactive Intestinal Peptide (VIP, CAS 40077-57-4) is supplied exclusively for qualified laboratory and scientific research purposes. This product is not approved for human or veterinary use in Canada, is not a drug or supplement, and has not been evaluated by Health Canada, the FDA, or any regulatory authority for safety or efficacy in any application within this context. No claims are made regarding therapeutic, diagnostic, or preventive properties. Researchers are responsible for ensuring all use complies with applicable institutional, regional, and federal regulations.
All products are intended for laboratory research use only. Not for human or veterinary use.
Product Reviews
Customer feedback
Read feedback from customers who have purchased this product, or be the first to share your experience.
Frequently Asked Questions
Everything you need to know before ordering
Product Quality Summary is available on every product page. Independent third-party Certificates of Analysis are available upon request for select batches and may be verified directly with the testing laboratory.
Please note that all sales are final. Due to the nature of our products and inventory, we are unable to accept returns. Product quality is independently assessed via 3rd party laboratory testing to ensure quality, and all purchases made via this website are done with the implied consent that you acknowledge and accept the empirical testing provided on each product page. In the event of dissatisfaction or quality concern, please consult with us via email so that we can try to assist.
We ship to addresses within Canada only. All orders are shipped domestically via Xpress Post with Canada Post to ensure safe, discreet delivery.
Most orders ship the same business day. Orders within the Greater Toronto Area (GTA) typically arrive within 1–2 business days, while more rural or remote areas can expect 3–5 business days. FlexDelivery and PO Boxes are supported. Please note these are average delivery times — delays may occasionally occur due to courier issues or remote locations.
Every peptide product sold on our site is lab-tested before it's listed. If a product hasn't been tested, we don't sell it.
Unless otherwise noted on the product page, all NexPept research compounds are supplied as lyophilized (freeze-dried) powder for laboratory research use. Physical form and net quantity are listed individually on each product page.